Antibodies

Jump to Filters
View as table Download
SMPX Rabbit Polyclonal Antibody
TA346128

USD 410.00

5 Days

Rabbit Polyclonal Anti-SMPX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMPX antibody: synthetic peptide directed towards the middle region of human SMPX. Synthetic peptide located within the following region: TPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ
SMPX Rabbit Polyclonal Antibody
TA381797

USD 220.00

3 Weeks

SMPX Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-88 of human SMPX (NP_055147.1).
Modifications Unmodified