SMPX Rabbit Polyclonal Antibody

CAT#: TA346128

Rabbit Polyclonal Anti-SMPX Antibody

Product Images

WB Suggested Anti-SMPX Antibody Titration: 2.5 ug/ml; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SMPX antibody: synthetic peptide directed towards the middle region of human SMPX. Synthetic peptide located within the following region: TPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 9 kDa
• Gene Name: small muscle protein, X-linked
• Database Link:
  NP_055147
  Entrez Gene 23676 Human
  UniProt ID Q9UHP9
• Background: SMPX plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.
• Synonyms: DFN6; DFNX4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 79%