SMPX (NM_014332) Human Recombinant Protein
CAT#: TP303277
Recombinant protein of human small muscle protein, X-linked (SMPX)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203277 protein sequence
Red=Cloning site Green=Tags(s) MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNL SEIQNIKSELKYVPKAEQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055147 |
Locus ID | 23676 |
UniProt ID | Q9UHP9, A0A024RBY1 |
Cytogenetics | Xp22.12 |
Refseq Size | 951 |
Refseq ORF | 264 |
Synonyms | Chisel; Csl; DFN6; DFNX4 |
Summary | This gene encodes a small protein that has no known functional domains. Mutations in this gene are a cause of X-linked deafness-4, and the encoded protein may play a role in the maintenance of inner ear cells subjected to mechanical stress. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415310 | SMPX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415310 | Transient overexpression lysate of small muscle protein, X-linked (SMPX) |
USD 396.00 |
|
PH303277 | SMPX MS Standard C13 and N15-labeled recombinant protein (NP_055147) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review