SMPX (NM_014332) Human Mass Spec Standard

CAT#: PH303277

SMPX MS Standard C13 and N15-labeled recombinant protein (NP_055147)

Product Images

Coomassie blue staining of purified SMPX protein (Cat# TP303277). The protein was produced from HEK293T cells transfected with SMPX cDNA clone (Cat# RC203277) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203277
• Predicted MW: 9.6 kDa
• Protein Sequence:
  Sequence Link

  >RC203277 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNL
  SEIQNIKSELKYVPKAEQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055147
• RefSeq Size: 951
• RefSeq ORF: 264
• Synonyms: DFN6; DFNX4
• Locus ID: 23676
• UniProt ID: Q9UHP9, A0A024RBY1
• Cytogenetics: Xp22.12
• Summary: This gene encodes a small protein that has no known functional domains. Mutations in this gene are a cause of X-linked deafness-4, and the encoded protein may play a role in the maintenance of inner ear cells subjected to mechanical stress. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2011]