Antibodies

View as table Download

Rabbit Polyclonal Anti-Spa17 Antibody

Applications WB
Reactivities Rat
Immunogen The immunogen for Anti-Spa17 Antibody is: synthetic peptide directed towards the middle region of Rat Spa17. Synthetic peptide located within the following region: AYFENLLEKREKTSFDPAEWGAKVEDRFYNNHAFKDPEQAEKCEQEIAKA

Rabbit Polyclonal Anti-SPA17 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPA17 Antibody: synthetic peptide directed towards the N terminal of human SPA17. Synthetic peptide located within the following region: MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKR

Carrier-free (BSA/glycerol-free) SPA17 mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SPA17 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) SPA17 mouse monoclonal antibody, clone OTI4A2 (formerly 4A2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SPA17 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SPA17 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SPA17 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SPA17 mouse monoclonal antibody, clone OTI6F10 (formerly 6F10)

Applications WB
Reactivities Human
Conjugation Unconjugated

SPA17 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-151 of human SPA17 (NP_059121.1).
Modifications Unmodified

Purified SPA17 mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)

Applications WB
Reactivities Human
Conjugation Unconjugated

Purified SPA17 mouse monoclonal antibody, clone OTI2G6 (formerly 2G6), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

Purified SPA17 mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)

Applications WB
Reactivities Human
Conjugation Unconjugated

SPA17 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications WB
Reactivities Human
Conjugation Unconjugated

SPA17 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications WB
Reactivities Human
Conjugation Unconjugated

SPA17 mouse monoclonal antibody, clone OTI4A2 (formerly 4A2)

Applications WB
Reactivities Human
Conjugation Unconjugated

SPA17 mouse monoclonal antibody, clone OTI4A2 (formerly 4A2)

Applications WB
Reactivities Human
Conjugation Unconjugated

SPA17 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications WB
Reactivities Human
Conjugation Unconjugated

SPA17 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications WB
Reactivities Human
Conjugation Unconjugated

SPA17 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications WB
Reactivities Human
Conjugation Unconjugated

SPA17 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications WB
Reactivities Human
Conjugation Unconjugated

SPA17 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications WB
Reactivities Human
Conjugation Unconjugated

SPA17 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications WB
Reactivities Human
Conjugation Unconjugated

Purified SPA17 mouse monoclonal antibody, clone OTI6F10 (formerly 6F10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Purified SPA17 mouse monoclonal antibody, clone OTI6F10 (formerly 6F10)

Applications WB
Reactivities Human
Conjugation Unconjugated