Spa17 Rabbit Polyclonal Antibody

CAT#: TA335411

Rabbit Polyclonal Anti-Spa17 Antibody

Product Images

WB Suggested Anti-Spa17 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Spa17 Antibody is: synthetic peptide directed towards the middle region of Rat Spa17. Synthetic peptide located within the following region: AYFENLLEKREKTSFDPAEWGAKVEDRFYNNHAFKDPEQAEKCEQEIAKA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: sperm autoantigenic protein 17
• Database Link:
  NP_445934
  Entrez Gene 85244 Rat
• Background: Spa17 is a component of sperm acrosome; Spa17 binds A-kinase anchoring protein 3 (Akap3) and is thought to be involved in fertilization by binding to the zona pellucida of the oocyte?
• Synonyms: CT22; SP17; SP17-1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Sheep: 93%; Bovine: 93%