SPAG8 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 390-419 amino acids from the C-terminal region of Human SPAG8 |
SPAG8 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 390-419 amino acids from the C-terminal region of Human SPAG8 |
Rabbit polyclonal Anti-SPAG8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SPAG8 antibody: synthetic peptide directed towards the N terminal of human SPAG8. Synthetic peptide located within the following region: SGPVLGSSSGAGHGSGSGSGPGCGSVPGSGSGPGPGSGPGSGPGHGSGSH |
Rabbit polyclonal Anti-SPAG8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SPAG8 antibody: synthetic peptide directed towards the middle region of human SPAG8. Synthetic peptide located within the following region: PAPTKPHDYRQEQPETFWIQRAPQLPTWWPLPTQVPAAEDYLTWKEWGFT |
Anti-SPAG8 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 205-426 amino acids of human sperm associated antigen 8 |
Anti-SPAG8 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 205-426 amino acids of human sperm associated antigen 8 |
SPAG8 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 220-420 of human SPAG8 (NP_758516.1). |
Modifications | Unmodified |