Rabbit Polyclonal Anti-SPDEF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPDEF antibody: synthetic peptide directed towards the C terminal of human SPDEF. Synthetic peptide located within the following region: FKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLV |
SPDEF rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SPDEF |
Rabbit Polyclonal anti-SPDEF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPDEF antibody: synthetic peptide directed towards the N terminal of human SPDEF. Synthetic peptide located within the following region: AAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGA |
Rabbit Polyclonal Anti-SPDEF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPDEF antibody: synthetic peptide directed towards the middle region of human SPDEF. Synthetic peptide located within the following region: ELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTS |
Rabbit Polyclonal Anti-SPDEF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPDEF antibody: synthetic peptide directed towards the N terminal of human SPDEF. Synthetic peptide located within the following region: AAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQ |
Anti-SPDEF Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 129-332 amino acids of human SAM pointed domain containing ets transcription factor |
SPDEF rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SPDEF |
Germany
Japan
United Kingdom
China