SPDEF Rabbit Polyclonal Antibody

CAT#: TA343701

Rabbit Polyclonal Anti-SPDEF Antibody

Product Images

WB Suggested Anti-SPDEF Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SPDEF antibody: synthetic peptide directed towards the C terminal of human SPDEF. Synthetic peptide located within the following region: FKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: SAM pointed domain containing ETS transcription factor
• Database Link:
  NP_036523
  Entrez Gene 25803 Human
  UniProt ID O95238
• Background: PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA expression.
• Synonyms: bA375E1.3; PDEF
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors