Antibodies

Jump to Filters
View as table Download
SPECC1 Rabbit Polyclonal Antibody
TA301748

USD 424.00

5 Days

Rabbit Polyclonal Antibody against NSP-5a3a

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen An internal synthetic peptide made to the human NSP5a3a protein sequence (between residues 1-100).
SPECC1 Rabbit Polyclonal Antibody
TA343199

USD 375.00

5 Days

Rabbit Polyclonal Anti-SPECC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPECC1 antibody is: synthetic peptide directed towards the N-terminal region of Human SPECC1. Synthetic peptide located within the following region: RTPSTKPKQENEGGEKAALESQVRELLAEAKAKDSEINRLRSELKKYKEK
SPECC1 Rabbit Polyclonal Antibody
TA301749

USD 424.00

5 Days

Rabbit Polyclonal Antibody against NSP-5a3a

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen An internal synthetic peptide made to the human NSP5a3a protein sequence (between residues 200-300).