Antibodies

Jump to Filters
View as table Download
SPINK6 Rabbit Polyclonal Antibody
TA316465

USD 345.00

In Stock

Rabbit polyclonal anti-SPINK6 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SPINK6.
SPINK6 Rabbit Polyclonal Antibody
TA333313

USD 375.00

5 Days

Rabbit Polyclonal Anti-SPINK6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPINK6 Antibody: synthetic peptide directed towards the middle region of human SPINK6. Synthetic peptide located within the following region: GEFQDPKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKHPGKC