SPINK6 Rabbit Polyclonal Antibody

CAT#: TA333313

Rabbit Polyclonal Anti-SPINK6 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SPINK6"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SPINK6 Antibody: synthetic peptide directed towards the middle region of human SPINK6. Synthetic peptide located within the following region: GEFQDPKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKHPGKC
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 8 kDa
Gene Name serine peptidase inhibitor, Kazal type 6
Background The protein encoded by this gene is a Kazal-type serine protease inhibitor that acts on kallikrein-related peptidases in the skin. Two transcript variants the same protein have been found for this gene.
Synonyms BUSI2; UNQ844
Note Immunogen sequence homology: Human: 100%; Pig: 93%; Dog: 85%; Horse: 85%; Bovine: 85%; Guinea pig: 85%
Reference Data
Protein Families Secreted Protein, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.