Antibodies

Jump to Filters
View as table Download
STAMBPL1 Rabbit Polyclonal Antibody
TA344761

USD 475.00

5 Days

Rabbit Polyclonal Anti-STAMBPL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STAMBPL1 antibody: synthetic peptide directed towards the N terminal of human STAMBPL1. Synthetic peptide located within the following region: MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR
STAMBPL1 Rabbit Polyclonal Antibody
TA359278

USD 360.00

5 Days

STAMBPL1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human STAMBPL1
STAMBPL1 Rabbit Polyclonal Antibody
TA382078

USD 220.00

3 Weeks

STAMBPL1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-250 of human STAMBPL1 (NP_065850.1).
Modifications Unmodified