Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-STC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STC1 antibody: synthetic peptide directed towards the N terminal of human STC1. Synthetic peptide located within the following region: MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSAL |
Rabbit Polyclonal Anti-Stc1 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Stc1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Stc1. Synthetic peptide located within the following region: EKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEG |
Stanniocalcin 1 (STC1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 192-221aa) of human Stanniocalcin-1. |
Carrier-free (BSA/glycerol-free) STC1 mouse monoclonal antibody,clone OTI1E9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-STC1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human STC1 |
STC1 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse STC1 |
STC1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 18-247 of human STC1 (NP_003146.1). |
STC1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 18-247 of human STC1 (NP_003146.1). |
| Modifications | Unmodified |
STC1 mouse monoclonal antibody,clone OTI1E9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
STC1 mouse monoclonal antibody,clone OTI1E9, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
STC1 mouse monoclonal antibody,clone OTI1E9, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
STC1 mouse monoclonal antibody,clone OTI1E9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
STC1 mouse monoclonal antibody,clone OTI6D12
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- STC1