Antibodies

Jump to Filters
View as table Download
STOX2 (C-term) Rabbit Polyclonal Antibody
AP31269PU-N

USD 440.00

2 Weeks

STOX2 (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated
STOX2 Rabbit Polyclonal Antibody
TA319971

USD 430.00

5 Days

Rabbit Polyclonal STOX2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen STOX2 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human STOX2.
STOX2 Rabbit Polyclonal Antibody
TA330702

USD 375.00

5 Days

Rabbit Polyclonal Anti-STOX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-STOX2 antibody is: synthetic peptide directed towards the C-terminal region of Human STOX2. Synthetic peptide located within the following region: NKNTEEEKNREDVGTMQWLLEREKERDLQRKFEKNLTLLAPKETDSSSNQ