STOX2 Rabbit Polyclonal Antibody

CAT#: TA330702

Rabbit Polyclonal Anti-STOX2 Antibody

Product Images

Host: Rabbit; Target Name: STOX2; Sample Tissue: ACHN Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-STOX2 antibody is: synthetic peptide directed towards the C-terminal region of Human STOX2. Synthetic peptide located within the following region: NKNTEEEKNREDVGTMQWLLEREKERDLQRKFEKNLTLLAPKETDSSSNQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 94 kDa
• Gene Name: storkhead box 2
• Database Link:
  NP_064610
  Entrez Gene 56977 Human
  UniProt ID Q9P2F5
• Background: The function of this protein remains unknown.
• Synonyms: DKFZp762K222
• Note: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Dog: 91%; Mouse: 86%; Bovine: 86%; Rabbit: 86%