Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal STRA6 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Anti-STRA6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STRA6 antibody: synthetic peptide directed towards the N terminal of human STRA6. Synthetic peptide located within the following region: MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG |
Goat Anti-STRA6 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QAFRKAALTSAKAN, from the C Terminus of the protein sequence according to NP_033317.1; NP_001025095.1. |
Rabbit Polyclonal Anti-STRA6 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human STRA6 |
STRA6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 538-667 of human STRA6 (NP_071764.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- STRA6