Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-STRAD Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STRAD Antibody: A synthesized peptide derived from human STRAD |
Antibodies
View as table Download
Rabbit polyclonal anti-STRAD antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human STRAD. |
Rabbit polyclonal Anti-LYK5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYK5 antibody: synthetic peptide directed towards the N terminal of human LYK5. Synthetic peptide located within the following region: MSFLTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNL |
Rabbit polyclonal Anti-LYK5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYK5 antibody: synthetic peptide directed towards the C terminal of human LYK5. Synthetic peptide located within the following region: AEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFV |
STRADA Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse STRADA |
STRADA rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
STRADA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-210 of human STRADA (NP_699166.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- STRADA