Germany
Japan
United Kingdom
China
Rabbit polyclonal antibody to Syntaxin 4 (syntaxin 4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 92 and 297 of Syntaxin 4 (Uniprot ID#Q12846) |
Antibodies
View as table Download
Rabbit Polyclonal Anti-STX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STX4 antibody: synthetic peptide directed towards the C terminal of human STX4. Synthetic peptide located within the following region: VEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV |
Rabbit Polyclonal Anti-STX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STX4 antibody: synthetic peptide directed towards the middle region of human STX4. Synthetic peptide located within the following region: LKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE |
STX4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human STX4 |
Syntaxin 4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-275 of human Syntaxin 4 (NP_004595.2). |
| Modifications | Unmodified |
Syntaxin 4 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- STX4