Syntaxin 4 (STX4) Rabbit Polyclonal Antibody

CAT#: TA342643

Rabbit Polyclonal Anti-STX4 Antibody

Product Images

WB Suggested Anti-STX4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STX4 antibody: synthetic peptide directed towards the middle region of human STX4. Synthetic peptide located within the following region: LKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: syntaxin 4
• Database Link:
  NP_004595
  Entrez Gene 6810 Human
  UniProt ID Q12846
• Background: STX4 is a plasma membrane t-SNARE that mediates docking of transport vesicles.STX4 is necessary for the translocation of SLC2A4 from intracellular vesicles to the plasma membrane. Together with STXB3 and VAMP2, STX4 may also play a role in docking/fusion of intracellular GLUT4-containing vesicles with the cell surface in adipocytes . STX4 may also play a role in docking of synaptic vesicles at presynaptic active zones.
• Synonyms: p35-2; STX4A
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport