Rabbit anti-STXBP1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human STXBP1 |
Rabbit anti-STXBP1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human STXBP1 |
Munc18 1 (STXBP1) mouse monoclonal antibody, clone 6D1, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Munc18 1 (STXBP1) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide - KLH conjugated |
Goat Polyclonal Antibody against STXBP1
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SRVSFEDQAPTME, from the C Terminus of the protein sequence according to NP_003156.1. |
Rabbit Polyclonal Anti-STXBP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STXBP1 antibody: synthetic peptide directed towards the middle region of human STXBP1. Synthetic peptide located within the following region: TRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIFILGGVSLNEMRCA |
Rabbit Polyclonal Anti-STXBP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human STXBP1 |
STXBP1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human STXBP1 |