Antibodies

View as table Download

Rabbit anti-STXBP1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Recombinant protein of human STXBP1

Munc18 1 (STXBP1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated

Goat Polyclonal Antibody against STXBP1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-SRVSFEDQAPTME, from the C Terminus of the protein sequence according to NP_003156.1.

Rabbit Polyclonal Anti-STXBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STXBP1 antibody: synthetic peptide directed towards the middle region of human STXBP1. Synthetic peptide located within the following region: TRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIFILGGVSLNEMRCA

Rabbit Polyclonal Anti-STXBP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human STXBP1

STXBP1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human STXBP1