Munc18 1 (STXBP1) Rabbit Polyclonal Antibody

CAT#: TA330016

Rabbit Polyclonal Anti-STXBP1 Antibody

Product Images

WB Suggested Anti-STXBP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:100; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STXBP1 antibody: synthetic peptide directed towards the middle region of human STXBP1. Synthetic peptide located within the following region: TRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIFILGGVSLNEMRCA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: syntaxin binding protein 1
• Database Link:
  NP_001027392
  Entrez Gene 6812 Human
  UniProt ID P61764
• Background: STXBP1 belongs to the STXBP/unc-18/SEC1 family. It may participate in the regulation of synaptic vesicle docking and fusion, possibly through interaction with GTP-binding proteins. The protein is essential for neurotransmission and binds syntaxin, a component of the synaptic vesicle fusion machinery probably in a 1:1 ratio. It can interact with syntaxins 1, 2, and 3 but not syntaxin 4.
• Synonyms: MUNC18-1; NSEC1; P67; RBSEC1; UNC18
• Note: Immunogen sequence homology: African clawed frog: 100%; Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Zebrafish: 86%