Rabbit Polyclonal Anti-SUSD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUSD4 antibody: synthetic peptide directed towards the N terminal of human SUSD4. Synthetic peptide located within the following region: MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGG |
Rabbit Polyclonal Anti-SUSD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUSD4 antibody: synthetic peptide directed towards the middle region of human SUSD4. Synthetic peptide located within the following region: HGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQV |
SUSD4 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse SUSD4 |
Germany
Japan
United Kingdom
China
