SUSD4 Rabbit Polyclonal Antibody

CAT#: TA342349

Rabbit Polyclonal Anti-SUSD4 Antibody

Product Images

WB Suggested Anti-SUSD4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Human Lung

• 

  Host: Rabbit; Target Name: SUSD4; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SUSD4 antibody: synthetic peptide directed towards the N terminal of human SUSD4. Synthetic peptide located within the following region: MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: sushi domain containing 4
• Database Link:
  NP_001032252
  Entrez Gene 55061 Human
  UniProt ID Q5VX71
• Background: SUSD4 contains 4 Sushi (CCP/SCR) domains. It is a single-pass type I membrane protein. The function of the SUSD4 protein remains unknown.
• Synonyms: PRO222
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Yeast: 92%; Rabbit: 85%

Reference Data

• Protein Families: Transmembrane