Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Synaptogyrin 2 (SYNGR2) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 27-56 amino acids from the N-terminal region of human SYNGR2 |
Goat Polyclonal Antibody against SYNGR2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CIYGEGYSNAHESKQ, from the internal region of the protein sequence according to NP_004701.1. |
SYNGR2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | SYNGR2 / Synaptogyrin 2 antibody was raised against synthetic 17 amino acid peptide from N-Terminus of human SYNGR2 / Synaptogyrin 2. Percent identity with other species by BLAST analysis: Human (100%); Gibbon, Monkey, Marmoset (82%). |
SYNGR2 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | SYNGR2 / Synaptogyrin 2 antibody was raised against synthetic 14 amino acid peptide from internal region of human SYNGR2 / Synaptogyrin 2. Percent identity with other species by BLAST analysis: Human (100%); Marmoset (93%); Monkey (86%). |
SYNGR2 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Hamster, Horse, Human, Mouse, Orang-Utan, Rat |
| Immunogen | SYNGR2 / Synaptogyrin 2 antibody was raised against synthetic 18 amino acid peptide from internal region of human SYNGR2 / Synaptogyrin 2. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey, Mouse, Rat, Hamster, Panda, Bovine, Horse (100%); Marmoset, Elephant, Guinea pig (94%); Galago, Dog, Rabbit (89%); Opossum (83%). |
Rabbit Polyclonal Anti-SYNGR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYNGR2 antibody: synthetic peptide directed towards the N terminal of human SYNGR2. Synthetic peptide located within the following region: ESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNA |
SYNGR2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SYNGR2 |
Active filters
Target Symbol
- SYNGR2