Synaptogyrin 2 (SYNGR2) Rabbit Polyclonal Antibody

CAT#: TA339427

Rabbit Polyclonal Anti-SYNGR2 Antibody

Product Images

WB Suggested Anti-SYNGR2 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate.SYNGR2 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SYNGR2 antibody: synthetic peptide directed towards the N terminal of human SYNGR2. Synthetic peptide located within the following region: ESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: synaptogyrin 2
• Database Link:
  NP_004701
  Entrez Gene 9144 Human
  UniProt ID O43760
• Background: This gene encodes an integral membrane protein containing four transmembrane regions and a C-terminal cytoplasmic tail that is tyrosine phosphorylated. The exact function of this protein is unclear, but studies of a similar rat protein suggest that it may play a role in regulating membrane traffic in non-neuronal cells. The gene belongs to the synaptogyrin gene family. [provided by RefSeq, Jul 2008]
• Synonyms: MGC102914
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Bovine: 86%; Zebrafish: 83%

Reference Data

• Protein Families: Transmembrane