TA3 / TAAR9 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | TAAR9 antibody was raised against synthetic 13 amino acid peptide from 3rd extracellular domain of human TAAR9. Percent identity with other species by BLAST analysis: Human (100%); Hamster (92%); Galago, Mouse, Rat, Bovine, Pig (85%). |
Rabbit Polyclonal Anti-TAAR9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAAR9 Antibody is: synthetic peptide directed towards the C-terminal region of Human TAAR9. Synthetic peptide located within the following region: RVAKRERKAAKTLGIAMAAFLVSWLPYLVDAVIDAYMNFITPPYVYEILV |
Germany
Japan
United Kingdom
China