TA3 (TAAR9) Rabbit Polyclonal Antibody

CAT#: TA331584

Rabbit Polyclonal Anti-TAAR9 Antibody

Product Images

Host: Rabbit; Target Name: TAAR9; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TAAR9 Antibody is: synthetic peptide directed towards the C-terminal region of Human TAAR9. Synthetic peptide located within the following region: RVAKRERKAAKTLGIAMAAFLVSWLPYLVDAVIDAYMNFITPPYVYEILV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: trace amine associated receptor 9 (gene/pseudogene)
• Database Link:
  NP_778227
  Entrez Gene 134860 Human
  UniProt ID Q96RI9
• Background: TAAR9 is a member of a large family of rhodopsin G protein-coupled receptors (GPCRs, or GPRs). GPCRs contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins.
• Synonyms: TA3; TAR3; TAR9; TRAR3
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Neuroactive ligand-receptor interaction