Antibodies

Jump to Filters
View as table Download
TBKBP1 Rabbit Polyclonal Antibody
TA306842

USD 430.00

5 Days

Rabbit Polyclonal Prosapip2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Prosapip2 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human Prosapip2.
TBKBP1 Rabbit Polyclonal Antibody
TA336976

USD 402.00

5 Days

Rabbit Polyclonal TBKBP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A portion of amino acids 300-350 of human SINTBAD/TBKBP1 was used as the immunogen.
TBKBP1 Rabbit Polyclonal Antibody
TA331972

USD 375.00

5 Days

Rabbit Polyclonal Anti-TBKBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TBKBP1 Antibody is: synthetic peptide directed towards the N-terminal region of Human TBKBP1. Synthetic peptide located within the following region: ELQKNKEQEEQLGEMIQAYEKLCVEKSDLETELREMRALVETHLRQICGL
TBKBP1 Rabbit Polyclonal Antibody
TA359121

USD 360.00

5 Days

TBKBP1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human TBKBP1