Germany
Japan
United Kingdom
China
TCL1A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TCL1A |
Antibodies
View as table Download
Rabbit Polyclonal Anti-TCL1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCL1A antibody: synthetic peptide directed towards the N terminal of human TCL1A. Synthetic peptide located within the following region: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL |
Mouse Anti-Human TCL1 Purified (25 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against TCL1A
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLYPDGRYRSSD, from the internal region of the protein sequence according to NP_068801.1. |
Anti-TCL1A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Mouse Monoclonal TCL1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- TCL1A