Tcl1 (TCL1A) Rabbit Polyclonal Antibody

CAT#: TA344195

Rabbit Polyclonal Anti-TCL1A Antibody - N-terminal region

Product Images

WB Suggested Anti-TCL1A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TCL1A antibody: synthetic peptide directed towards the N terminal of human TCL1A. Synthetic peptide located within the following region: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 13 kDa
• Gene Name: T-cell leukemia/lymphoma 1A
• Database Link:
  NP_068801
  Entrez Gene 8115 Human
  UniProt ID P56279
• Background: TCL1A can enhance the phosphorylation and activation of AKT1, AKT2 and AKT3;promote nuclear translocation of AKT1;enhance cell proliferation, stabilize mitochondrial membrane potential and promote cell survival.
• Synonyms: TCL1
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome