Rabbit polyclonal Anti-TCP11L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCP11L2 antibody: synthetic peptide directed towards the N terminal of human TCP11L2. Synthetic peptide located within the following region: VHQAFWDVLDSELNADPPEFEHAIKLFEEIREILLSFLTPGGNRLRNQIC |
Carrier-free (BSA/glycerol-free) TCP11L2 mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TCP11L2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-340 of human TCP11L2 (NP_689985.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
TCP11L2 mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TCP11L2 mouse monoclonal antibody, clone OTI1F4 (formerly 1F4), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
TCP11L2 mouse monoclonal antibody, clone OTI1F4 (formerly 1F4), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TCP11L2 mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
