TCP11L2 Rabbit Polyclonal Antibody

CAT#: TA329794

Rabbit polyclonal Anti-TCP11L2 Antibody

Product Images

WB Suggested Anti-TCP11L2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Fetal heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TCP11L2 antibody: synthetic peptide directed towards the N terminal of human TCP11L2. Synthetic peptide located within the following region: VHQAFWDVLDSELNADPPEFEHAIKLFEEIREILLSFLTPGGNRLRNQIC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: t-complex 11 like 2
• Database Link:
  NP_689985
  Entrez Gene 255394 Human
  UniProt ID Q8N4U5
• Background: The specific function of TCP11L2 is not yet known.
• Synonyms: MGC40368
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Rat: 86%; Mouse: 86%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome