Antibodies

View as table Download

Rabbit Polyclonal Anti-TCTA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCTA antibody: synthetic peptide directed towards the middle region of human TCTA. Synthetic peptide located within the following region: IQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHR

TCTA Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human TCTA (NP_071503.1).
Modifications Unmodified