TCTA Rabbit Polyclonal Antibody

CAT#: TA338492

Rabbit Polyclonal Anti-TCTA Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TCTA"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TCTA antibody: synthetic peptide directed towards the middle region of human TCTA. Synthetic peptide located within the following region: IQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 11 kDa
Gene Name T-cell leukemia translocation altered
Background A chromosomal aberration, translocation t(1;3)(p34;p21), involving TCTA is associated with T-cell acute lymphoblastic leukemia (T-ALL).
Synonyms 9130410M22Rik; AW553637; C85065; Tctal
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 86%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.