Antibodies

Jump to Filters
View as table Download
C1orf223 (TEX38) Rabbit Polyclonal Antibody
TA334877

USD 375.00

5 Days

Rabbit Polyclonal Anti-TEX38 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TEX38 antibody is: synthetic peptide directed towards the middle region of Human TEX38. Synthetic peptide located within the following region: PDVLWDLDIPEGRSHADQDSNPKAEAPAPLQPALQLAPQQPQARSPFPLP