C1orf223 (TEX38) Rabbit Polyclonal Antibody

CAT#: TA334877

Rabbit Polyclonal Anti-TEX38 Antibody

Product Images

Host: Rabbit; Target Name: TEX38; Sample Tissue: Hela Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TEX38 antibody is: synthetic peptide directed towards the middle region of Human TEX38. Synthetic peptide located within the following region: PDVLWDLDIPEGRSHADQDSNPKAEAPAPLQPALQLAPQQPQARSPFPLP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: testis expressed 38
• Database Link:
  NP_001138946
  Entrez Gene 374973 Human
  UniProt ID Q6PEX7
• Background: The function of this protein remains unknown.
• Synonyms: ATPAF1-AS1; C1orf223; THEG4
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane