Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against TFEC
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence TLDHQIINPTLK-C, from the N Terminus of the protein sequence according to NP_036384.1; NP_001018068.1. |
Rabbit Polyclonal Anti-TFEC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFEC antibody: synthetic peptide directed towards the N terminal of human TFEC. Synthetic peptide located within the following region: MESSFKEEGADSPLLMQRTLSGSILDVYSGEQGISPINMGLTSASCPSSL |
Carrier-free (BSA/glycerol-free) TFEC mouse monoclonal antibody,clone OTI1B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TFEC mouse monoclonal antibody,clone OTI2A9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TFEC mouse monoclonal antibody,clone OTI1B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TFEC mouse monoclonal antibody,clone OTI1B4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
TFEC mouse monoclonal antibody,clone OTI1B4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TFEC mouse monoclonal antibody,clone OTI1B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TFEC mouse monoclonal antibody,clone OTI2A9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TFEC mouse monoclonal antibody,clone OTI2A9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
TFEC mouse monoclonal antibody,clone OTI2A9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TFEC mouse monoclonal antibody,clone OTI2A9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- TFEC