TFEC Rabbit Polyclonal Antibody

CAT#: TA330228

Rabbit Polyclonal Anti-TFEC Antibody

Product Images

WB Suggested Anti-TFEC Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TFEC antibody: synthetic peptide directed towards the N terminal of human TFEC. Synthetic peptide located within the following region: MESSFKEEGADSPLLMQRTLSGSILDVYSGEQGISPINMGLTSASCPSSL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: transcription factor EC
• Database Link:
  NP_001018068
  Entrez Gene 22797 Human
  UniProt ID O14948
• Background: TFEC is an activator of transcription with two separate activation domains.
• Synonyms: bHLHe34; hTFEC-L; TCFEC; TFE-C; TFEC-L; TFECL
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors