Antibodies

Jump to Filters
View as table Download
C19orf52 (TIMM29) Rabbit Polyclonal Antibody
TA333546

USD 375.00

5 Days

Rabbit Polyclonal Anti-C19orf52 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C19orf52 Antibody is: synthetic peptide directed towards the C-terminal region of Human C19orf52. Synthetic peptide located within the following region: PQQLHSETNERLFDEKYKPVVLTDDQVDQALWEEQVLQKEKKDRLALSQA
C19orf52 (TIMM29) Mouse Monoclonal Antibody [Clone ID: OTI3C5]
CF811979

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) C19orf52 mouse monoclonal antibody,clone OTI3C5

Applications WB
Reactivities Human
Conjugation Unconjugated