C19orf52 (TIMM29) Rabbit Polyclonal Antibody

CAT#: TA333546

Rabbit Polyclonal Anti-C19orf52 Antibody

Product Images

Host: Rabbit; Target Name: C19orf52; Sample Tissue: Plancenta lysates; Antibody Dilution: 1.0 ug/ml.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C19orf52 Antibody is: synthetic peptide directed towards the C-terminal region of Human C19orf52. Synthetic peptide located within the following region: PQQLHSETNERLFDEKYKPVVLTDDQVDQALWEEQVLQKEKKDRLALSQA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: chromosome 19 open reading frame 52
• Database Link:
  NP_612367
  Entrez Gene 90580 Human
  UniProt ID Q9BSF4
• Background: The function of this protein remains unknown.
• Synonyms: C19orf52
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Guinea pig: 93%; Horse: 79%; Bovine: 79%