Rabbit Polyclonal Anti-TKTL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TKTL1 Antibody: synthetic peptide directed towards the middle region of human TKTL1. Synthetic peptide located within the following region: QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA |
Rabbit Polyclonal Anti-TKTL1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TKTL1 |
TKTL1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human TKTL1 |
TKTL1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TKTL1 |
TKTL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 220-340 of human TKTL1 (NP_036385.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
