TKTL1 Rabbit Polyclonal Antibody

CAT#: TA335653

Rabbit Polyclonal Anti-TKTL1 Antibody

Product Images

WB Suggested Anti-TKTL1 Antibody Titration: 1 ug/ml; Positive Control: Fetal Stomach cell lysate

• 

  Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0 ug/ml using anti-TKTL1 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TKTL1 Antibody: synthetic peptide directed towards the middle region of human TKTL1. Synthetic peptide located within the following region: QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: transketolase-like 1
• Database Link:
  NP_036385
  Entrez Gene 8277 Human
  UniProt ID P51854
• Background: Strong TKTL1 protein expression has been correlated with a certain type of glucose metabolism (aerobic glycolysis; Warburg effect) and to cells which are affected by chronic complications of diabetic patients. In colon and urothelial carcinomas, expression at the protein level is correlated with invasiveness of tumors and poor patient survival.
• Synonyms: TKR; TKT2
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 85%; Dog: 83%; Pig: 79%; Guinea pig: 79%; Rat: 77%; Horse: 77%; Rabbit: 77%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Pentose phosphate pathway