Antibodies

Jump to Filters
View as table Download
TM4SF4 (N-term) Rabbit Polyclonal Antibody
AP54133PU-N

USD 450.00

2 Weeks

TM4SF4 (N-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human T4S4
TM4SF4 Rabbit Polyclonal Antibody
TA339426

USD 375.00

5 Days

Rabbit Polyclonal Anti-TM4SF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TM4SF4 antibody: synthetic peptide directed towards the N terminal of human TM4SF4. Synthetic peptide located within the following region: CTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGG