TM4SF4 Rabbit Polyclonal Antibody

CAT#: TA339426

Rabbit Polyclonal Anti-TM4SF4 Antibody

Product Images

WB Suggested Anti-TM4SF4 Antibody Titration: 0.2-1ug/mL; Positive control: Jurkat cell lysate.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TM4SF4 antibody: synthetic peptide directed towards the N terminal of human TM4SF4. Synthetic peptide located within the following region: CTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: transmembrane 4 L six family member 4
• Database Link:
  NP_004608
  Entrez Gene 7104 Human
  UniProt ID P48230
• Background: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that can regulate cell proliferation. [provided by RefSeq, Mar 2011]
• Synonyms: il-TMP; ILTMP
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 79%; Bovine: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane