Antibodies

Jump to Filters
View as table Download
TMBIM4 (N-term) Rabbit Polyclonal Antibody
AP54281PU-N

USD 450.00

2 Weeks

TMBIM4 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human TMBIM4
TMBIM4 Rabbit Polyclonal Antibody
TA315494

USD 345.00

4 Weeks

Rabbit polyclonal anti-TMBIM4 antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TMBIM4.
TMBIM4 Rabbit Polyclonal Antibody
TA333785

USD 375.00

5 Days

Rabbit Polyclonal Anti-TMBIM4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TMBIM4 Antibody is: synthetic peptide directed towards the middle region of Human TMBIM4. Synthetic peptide located within the following region: LTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFAL