TMBIM4 Rabbit Polyclonal Antibody

CAT#: TA333785

Rabbit Polyclonal Anti-TMBIM4 Antibody

Product Images

WB Suggested Anti-TMBIM4 Antibody; Titration: 1.0 ug/ml; Positive Control: Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TMBIM4 Antibody is: synthetic peptide directed towards the middle region of Human TMBIM4. Synthetic peptide located within the following region: LTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFAL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: transmembrane BAX inhibitor motif containing 4
• Database Link:
  NP_057140
  Entrez Gene 51643 Human
  UniProt ID Q9HC24
• Background: TMBIM4 is an anti-apoptotic protein which can inhibit apoptosis induced by intrinsic and extrinsic apoptotic stimuli. It can modulate both capacitative Ca2+ entry and inositol 1,4,5-trisphosphate (IP3)-mediated Ca2+ release.
• Synonyms: CGI-119; GAAP; LFG4; S1R; ZPRO
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 86%

Reference Data

• Protein Families: Transmembrane