Antibodies

Jump to Filters
View as table Download
Porimin (TMEM123) Rabbit Polyclonal Antibody
TA342076

USD 375.00

5 Days

Rabbit Polyclonal Anti-TMEM123 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMEM123 antibody: synthetic peptide directed towards the C terminal of human TMEM123. Synthetic peptide located within the following region: SSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRG
Porimin (TMEM123) Rabbit Polyclonal Antibody
TA350294

USD 345.00

In Stock

Rabbit Polyclonal Anti-TMEM123 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TMEM123