Porimin (TMEM123) Rabbit Polyclonal Antibody

CAT#: TA342076

Rabbit Polyclonal Anti-TMEM123 Antibody

Product Images

WB Suggested Anti-TMEM123 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM123 antibody: synthetic peptide directed towards the C terminal of human TMEM123. Synthetic peptide located within the following region: SSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: transmembrane protein 123
• Database Link:
  NP_443164
  Entrez Gene 114908 Human
  UniProt ID Q8N131
• Background: TMEM123 is a highly glycosylated transmembrane protein with a high content of threonine and serine residues in its extracellular domain, similar to a broadly defined category of proteins termed mucins. Exposure of some cell types to anti-PORIMIN (pro-oncosis receptor inducing membrane injury) antibody, crosslinksThis protein onThe cell surface and induces a type of cell death termed oncosis. Oncosis is distinct from apoptosis and is characterized by a loss of cell membrane integrity without DNA fragmentation. TMEM123 is proposed to function as a cell surface receptor that mediates cell death.This gene encodes a highly glycosylated transmembrane protein with a high content of threonine and serine residues in its extracellular domain, similar to a broadly defined category of proteins termed mucins. Exposure of some cell types to anti-PORIMIN (pro-oncosis receptor inducing membrane injury) antibody, crosslinksThis protein onThe cell surface and induces a type of cell death termed oncosis. Oncosis is distinct from apoptosis and is characterized by a loss of cell membrane integrity without DNA fragmentation.This gene product is proposed to function as a cell surface receptor that mediates cell death.
• Synonyms: KCT3; PORIMIN; PORMIN
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane