Antibodies

View as table Download

Rabbit Polyclonal TMEM135 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TMEM135 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human TMEM135 .

Rabbit Polyclonal Anti-TMEM135 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMEM135 antibody: synthetic peptide directed towards the N terminal of human TMEM135. Synthetic peptide located within the following region: SLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTANGALYMAFFC